PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf06570g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 386aa    MW: 42468.6 Da    PI: 7.3694
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf06570g00008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.76.2e-3955115262
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                               ++  lkcprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ +
  Niben101Scf06570g00008.1  55 QQPPLKCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRIK 115
                               56789*****************************************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.2E-3358113IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.52559113IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-2759113IPR003851Zinc finger, Dof-type
PROSITE patternPS0136106197IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MLGDCEKMVL IPSSTTNEWP QQNIQSDEKT LMMSSNGSSN MEKPIQDPQQ QQQQQQPPLK  60
CPRCDSSNTK FCYYNNYSLS QPRHFCKACK RYWTRGGTLR NVPVGGGCRK NKRIKRPSAA  120
SSSTHDITIT SSSSLNNNIS ATNPSHHHNH IHGSPNIDLS STTSSNHLNP LFYGLNTERS  180
DLNNNPFSRL FSSRVSSATD EGQVYSLTTD SIPGLDRRLG LGFSSSGLVD ENNYVHGFNS  240
IKQIQDVMTN SNTTNSSSLL SSYPMFGSST ASSSTSTMAS LIASSLQQQK FMSNGNNFHG  300
LAPYEELQMS GNNNNNNNVE GGNGMPMLKE EKEEGGGNRL NWNNLSNHQN HQIHEQIMNS  360
SDPSLSWNGA WLDPSNMGSN SVPSLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016441727.10.0PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLM1CWS81e-128M1CWS8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000764471e-127(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-36Dof family protein